PDB entry 5i8n

View 5i8n on RCSB PDB site
Description: Solution Structure of human calcium-binding S100A9 (C3S) protein
Class: metal binding protein
Keywords: calgranulin B, homodimer, calcium-binding, migration inhibitory factor-related protein 14 (MRP14), METAL BINDING PROTEIN
Deposited on 2016-02-19, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06702 (0-113)
      • engineered mutation (2)
    Domains in SCOPe 2.06: d5i8na_
  • Chain 'B':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06702 (0-113)
      • engineered mutation (2)
    Domains in SCOPe 2.06: d5i8nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i8nA (A:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i8nB (B:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp