PDB entry 5i8l

View 5i8l on RCSB PDB site
Description: crystal structure of the full-length cell wall-binding module of cpl7 mutant r223a
Deposited on 2016-02-19, released 2017-03-08
The last revision was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: STREPTOCOCCUS PHAGE CP-7 [TaxId:10748]
    Gene: CPL7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19385 (1-End)
      • engineered mutation (25)
      • engineered mutation (73)
      • engineered mutation (121)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i8lA (A:)
    mentlkslttvaneviqglwgngqeaydslanagydpqavqdkvneilnareiadlttva
    neviqglwgngqeaydslanagydpqavqdkvneilnareiadlttvaneviqglwgngq
    eaydslanagydpqavqdkvnells
    

    Sequence, based on observed residues (ATOM records):
    >5i8lA (A:)
    entlkslttvaneviqglwgngqeaydslanagydpqavqdkvneilnareiadlttvan
    eviqglwgngqeaydslanagydpqavqdkvneilnareiadlttvaneviqglwgngqe
    aydslanagydpqavqdkvnell