PDB entry 5i8f

View 5i8f on RCSB PDB site
Description: Crystal structure of St. John's wort Hyp-1 protein in complex with melatonin
Class: plant protein
Keywords: plant hormone binding, phytohormone binding, melatonin, cytokinin, plant defense, pathogenesis-related protein, pr-10 protein, hypericin, depression, pr-10 fold, hydrophobic cavity, ans displacement assay (ada), plant protein
Deposited on 2016-02-18, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenolic oxidative coupling protein
    Species: Hypericum perforatum [TaxId:65561]
    Gene: hyp1
    Database cross-references and differences (RAF-indexed):
    • PDB 5I8F (Start-164)
    Domains in SCOPe 2.08: d5i8fa1, d5i8fa2
  • Heterogens: UNL, NA, ML1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5i8fA (A:)
gidpftmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtv
tkitfvdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskg
kitvtyhpkpgctvneeevkigekkayefykqveeylaanpevfa

    Sequence, based on observed residues (ATOM records): (download) 
    >5i8fA (A:)
idpftmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvt
kitfvdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgk
itvtyhpkpgctvneeevkigekkayefykqveeylaanpevfa