PDB entry 5i8d

View 5i8d on RCSB PDB site
Description: Crystal Structure of Mouse Cadherin-23 EC19-21 S2064P
Class: cell adhesion
Keywords: hearing, mechanotransduction, adhesion, calcium-binding protein, CELL ADHESION
Deposited on 2016-02-18, released 2017-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh23
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99PF4
      • engineered mutation (139)
    Domains in SCOPe 2.07: d5i8da1, d5i8da2, d5i8da3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i8dA (A:)
    mladendnhplftegtyqaevmenspagtpltvlngpilaldadedvyavvtyqllgths
    dlfvidnstgvvtvrsgiiidreafsppflellllaedigqlngtahlfitilddndnwp
    tfspptytvhllencppgfpvlqvtatdedsglngelvyrieagaqdrflihpvtgvirv
    gnatidreeqesyrltvvatdrgtvplsgtaivtiliddindsrpeflnpiqtvsvlesa
    epgtiianvtaidldlnpkleyhiisivakddtdrlvpdqedafavnintgsvmvkspln
    relvatyevtlsvidnasdlpehsvsvpnakltvnildvndnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i8dA (A:)
    endnhplftegtyqaevmenspagtpltvlngpilaldadedvyavvtyqllgthsdlfv
    idnstgvvtvrsgiiidreafsppflellllaedigqlngtahlfitilddndnwptfsp
    ptytvhllencppgfpvlqvtatdedsglngelvyrieagaqdrflihpvtgvirvgnat
    idreeqesyrltvvatdrgtvplsgtaivtiliddindsrpeflnpiqtvsvlesaepgt
    iianvtaidldlnpkleyhiisivakddtdrlvpdqedafavnintgsvmvksplnrelv
    atyevtlsvidnasdlpehsvsvpnakltvnildv