PDB entry 5i86

View 5i86 on RCSB PDB site
Description: Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone G02778174
Class: protein binding/inhibitor
Keywords: bromodomain inhibitor, PROTEIN BINDING-INHIBITOR complex
Deposited on 2016-02-18, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i86a_
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i86b_
  • Heterogens: EDO, SCN, 69A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i86A (A:)
    gskkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstik
    rkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i86A (A:)
    kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrk
    ldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i86B (B:)
    gskkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstik
    rkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i86B (B:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl