PDB entry 5i84

View 5i84 on RCSB PDB site
Description: Structure of the Xanthomonas citri phosphate-binding protein PhoX
Class: transport protein
Keywords: ABC transporter, periplasmic-binding protein, phosphate-binding protein, PhoX, TRANSPORT PROTEIN
Deposited on 2016-02-18, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84a_
  • Chain 'B':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84b_
  • Chain 'C':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84c_
  • Chain 'D':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84d_
  • Chain 'E':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84e_
  • Chain 'F':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84f_
  • Chain 'G':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84g_
  • Chain 'H':
    Compound: Phosphate-binding protein PstS
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: phoX, XAC1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i84h_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i84A (A:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84A (A:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywaknlph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i84B (B:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84B (B:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywaknlph
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5i84C (C:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84C (C:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawptatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtlv
    tqieaywaknlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5i84D (D:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84D (D:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywaknlph
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5i84E (E:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84E (E:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywaknlph
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5i84F (F:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84F (F:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywaknlph
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5i84G (G:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84G (G:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywaknlph
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5i84H (H:)
    mgsshhhhhssglvprgshmadvtgagasfiypvmskwsadynaatkkqvnyqsigsggg
    iaqikaasvdfgssdaplkpeelaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlg
    diflgkvstwndpaiaalnpgvklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvg
    egtavqwptgiggkgnegvaayvkqikggigyvelsyalqnkmaytamknaagkfvqpsd
    etfaaaansadwgtakdfylvmtnaagdnawpitatnfilvqkkpknpaglkntleffrw
    vytkgdaqakqldyvplpdtlvtqieaywaknlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i84H (H:)
    dvtgagasfiypvmskwsadynaatkkqvnyqsigsgggiaqikaasvdfgssdaplkpe
    elaaaglaqfpsviggvvpvvnvpgiaagtlkldgktlgdiflgkvstwndpaiaalnpg
    vklpegkitvvhrsdgsgtsfnftnylskvnpdwkgkvgegtavqwptgiggkgnegvaa
    yvkqikggigyvelsyalqnkmaytamknaagkfvqpsdetfaaaansadwgtakdfylv
    mtnaagdnawpitatnfilvqkkpknpaglkntleffrwvytkgdaqakqldyvplpdtl
    vtqieaywak