PDB entry 5i80

View 5i80 on RCSB PDB site
Description: brd4 in complex with cpd2 (n,n-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro- 1h-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
Deposited on 2016-02-18, released 2016-10-12
The last revision was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 67B, EDO, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5i80A (A:)
    stnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
    ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
    nelpte