PDB entry 5i7z

View 5i7z on RCSB PDB site
Description: crystal structure of a par-6 pdz-crumbs 3 c-terminal peptide complex
Deposited on 2016-02-18, released 2016-03-16
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LD29223p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: par-6, CG5884, Dmel_CG5884
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Crb-3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I7Z (Start-7)
  • Heterogens: PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5i7zA (A:)
    hrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavnde
    vievngievagktldqvtdmmvanssnliitvkpan
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i7zB (B:)
    lppeerli
    

    Sequence, based on observed residues (ATOM records):
    >5i7zB (B:)
    ppeerli