PDB entry 5i7m

View 5i7m on RCSB PDB site
Description: crystal structure of y345f mutant of human primase p58 iron-sulfur cluster domain
Deposited on 2016-02-17, released 2017-03-01
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase large subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRIM2, PRIM2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49643 (2-187)
      • expression tag (0-1)
      • engineered mutation (75)
  • Chain 'B':
    Compound: DNA primase large subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRIM2, PRIM2A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i7mA (A:)
    pnsldqidllstksfppcmrqlhkalrenhhlrhggrmqyglflkgigltleqalqfwkq
    efikgkmdpdkfdkgfsynirhsfgkegkrtdytpfsclkiilsnppsqgdyhgcpfrhs
    dpellkqklqsykispggisqildlvkgthyqvacqkyfemihnvddcgfslnhpnqffc
    esqrilng
    

    Sequence, based on observed residues (ATOM records):
    >5i7mA (A:)
    pnsldqidllstksfppcmrqlhkalrenhhlrhggrmqyglflkgigltleqalqfwkd
    kgfsynirhsdytpfsclkiilsnppsqgdyhgcpfrhsdpellkqklqsykispggisq
    ildlvkgthyqvacqkyfemihnvddcgfslnhpnqffcesqrilng
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i7mB (B:)
    pnsldqidllstksfppcmrqlhkalrenhhlrhggrmqyglflkgigltleqalqfwkq
    efikgkmdpdkfdkgfsynirhsfgkegkrtdytpfsclkiilsnppsqgdyhgcpfrhs
    dpellkqklqsykispggisqildlvkgthyqvacqkyfemihnvddcgfslnhpnqffc
    esqrilng
    

    Sequence, based on observed residues (ATOM records):
    >5i7mB (B:)
    sldqidllstksfppcmrqlhkalrenhhlrhggrmqyglflkgigltleqalqfwkqsy
    nirhsfytpfsclkiilsnppsqgdyhgcpfrhsdpellkqklqsykispggisqildlv
    kgthyqvacqkyfemihnvddcgfslnhpnqffcesqrilng