PDB entry 5i7j

View 5i7j on RCSB PDB site
Description: crystal structure of human splunc1 disulfide mutant m3 (i76c, v214c)
Deposited on 2016-02-17, released 2016-05-18
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BPI fold-containing family A member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BPIFA1, LUNX, NASG, PLUNC, SPLUNC1, SPURT, UNQ787/PRO1606
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP55
      • engineered mutation (59)
      • engineered mutation (197)
  • Chain 'B':
    Compound: BPI fold-containing family A member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BPIFA1, LUNX, NASG, PLUNC, SPLUNC1, SPURT, UNQ787/PRO1606
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP55
      • engineered mutation (59)
      • engineered mutation (197)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i7jA (A:)
    snaqfgglpvpldqtlplnvnpalplsptglagsltnalsngllsggllgilenlplldc
    lkpgggtsggllggllgkvtsvipglnniidikvtdpqllelglvqspdghrlyvtiplg
    iklqvntplvgasllrlavklditaeilavrdkqerihlvlgdcthspgslqislldglg
    plpiqglldsltgilnkclpelvqgnvcplvnevlrglditlvhdivnmlihglqfvikv
    

    Sequence, based on observed residues (ATOM records):
    >5i7jA (A:)
    sptglagsltnalsngllsggllgilenlplldclkgllgkvtsvipglnniidikvtdp
    qllelglvqspdghrlyvtiplgiklqvntplvgasllrlavklditaeilavrdkqeri
    hlvlgdcthspgslqislllpiqglldsltgilnkclpelvqgnvcplvnevlrglditl
    vhdivnmlihglqfvi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i7jB (B:)
    snaqfgglpvpldqtlplnvnpalplsptglagsltnalsngllsggllgilenlplldc
    lkpgggtsggllggllgkvtsvipglnniidikvtdpqllelglvqspdghrlyvtiplg
    iklqvntplvgasllrlavklditaeilavrdkqerihlvlgdcthspgslqislldglg
    plpiqglldsltgilnkclpelvqgnvcplvnevlrglditlvhdivnmlihglqfvikv
    

    Sequence, based on observed residues (ATOM records):
    >5i7jB (B:)
    sptglagsltnalsngllsggllgilenlplldclllgkvtsvipglnniidikvtdpql
    lelglvqspdghrlyvtiplgiklqvntplvgasllrlavklditaeilavrdkqerihl
    vlgdcthspgslqislldglgplpiqglldsltgilnkclpelvqgnvcplvnevlrgld
    itlvhdivnmlihglqfvik