PDB entry 5i78

View 5i78 on RCSB PDB site
Description: Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger
Class: hydrolase
Keywords: substrate binding, endoglucanase, HYDROLASE
Deposited on 2016-02-17, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-beta-1, 4-glucanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: eg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A023UH08 (3-303)
      • expression tag (0-2)
      • engineered mutation (239)
      • expression tag (304)
    Domains in SCOPe 2.07: d5i78a1, d5i78a2, d5i78a3
  • Chain 'B':
    Compound: Endo-beta-1, 4-glucanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: eg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A023UH08 (3-303)
      • expression tag (0-2)
      • engineered mutation (239)
      • expression tag (304)
    Domains in SCOPe 2.07: d5i78b1, d5i78b2, d5i78b3
  • Heterogens: CA, NAG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i78A (A:)
    aefvfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpd
    smtgsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqy
    kdndlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvn
    dnmknltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfiga
    yaggsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldi
    leayl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i78B (B:)
    aefvfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpd
    smtgsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqy
    kdndlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvn
    dnmknltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfiga
    yaggsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldi
    leayl