PDB entry 5i77

View 5i77 on RCSB PDB site
Description: Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger
Class: hydrolase
Keywords: substrate binding, endoglucanase, HYDROLASE
Deposited on 2016-02-17, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-beta-1, 4-glucanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: eg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i77a1, d5i77a2
  • Heterogens: CA, PGE, PEG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i77A (A:)
    vfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpdsmt
    gsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqykdn
    dlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvndnm
    knltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfigeyag
    gsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldilea
    yl