PDB entry 5i74

View 5i74 on RCSB PDB site
Description: x-ray structure of the ts3 human serotonin transporter complexed with br-citalopram at the central site
Deposited on 2016-02-16, released 2016-04-13
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium-dependent serotonin transporter
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC6A4, HTT, SERT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31645 (2-End)
      • cloning artifact (0-1)
      • engineered mutation (36)
      • engineered mutation (217)
      • engineered mutation (365)
      • engineered mutation (480)
      • engineered mutation (506)
  • Chain 'B':
    Compound: 8B6 antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I74 (0-End)
  • Chain 'C':
    Compound: 8B6 antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I74 (0-213)
  • Heterogens: 69D, NAG, CLR, D12, HEX

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i74A (A:)
    gsqgeretwgkkvdfllsvigyavdlgnvwrfpyicaqngggafllpytimaifggiplf
    ymelalgqyhrngcisiwrkicpifkgigyaiciiafyiasyyntimawalyylissftd
    qlpwtscknswntgnctnyfsednitwtlhstspaeefytrhvlqihrskglqdlggisw
    qlalcimliftviyfsiwkgvktsgkvvwvtatfpyialsvllvrgatlpgawrgvlfyl
    kpnwqklletgvwidaaaqiffslgpgfgvllafasynkfnnncyqdalvtsvvncmtsf
    vsgfviftvlgymaemrnedvsevakdagpsllfityaeaianmpastffaiifflmlit
    lgldssfaglegvitavldefphvwakrrerfvlavvitcffgslvtltfggayvvklle
    eyatgpavltvalieavavswfygitqfcrdvkemlgfspgwfwricwvaisplfllfii
    asflmsppqlrlfqynypywsiilgyaigtssficiptyiayrliitpgtfkeriiksit
    petptlvpr
    

    Sequence, based on observed residues (ATOM records):
    >5i74A (A:)
    gsqgeretwgkkvdfllsvigyavdlgnvwrfpyicaqngggafllpytimaifggiplf
    ymelalgqyhrngcisiwrkicpifkgigyaiciiafyiasyyntimawalyylissftd
    qlpwtscknswntgnctnyfsednitwtlhstspaeefytrhvlqihrskglqdlggisw
    qlalcimliftviyfsiwkgvktsgkvvwvtatfpyialsvllvrgatlpgawrgvlfyl
    kpnwqklletgvwidaaaqiffslgpgfgvllafasynkfnnncyqdalvtsvvncmtsf
    vsgfviftvlgymaemrnedvsevakdagpsllfityaeaianmpastffaiifflmlit
    lgldssfaglegvitavldefphvwakrrerfvlavvitcffgslvtltfggayvvklle
    eyatgpavltvalieavavswfygitqfcrdvkemlgfspgwfwricwvaisplfllfii
    asflmsppqlrlfqynypywsiilgyaigtssficiptyiayrliitpgtfkeriiksit
    pe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i74B (B:)
    evqlqqsgpelvkpgasvkisckasgytftdyymnwvkqshgkslewigninpnnggtsy
    nqkfkgkatltvdkssttaymelrsltsedsavyyctrspvrpyyfdywgqgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

    Sequence, based on observed residues (ATOM records):
    >5i74B (B:)
    evqlqqsgpelvkpgasvkisckasgytftdyymnwvkqshgkslewigninpnnggtsy
    nqkfkgkatltvdkssttaymelrsltsedsavyyctrspvrpyyfdywgqgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkklep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5i74C (C:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhysiprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec