PDB entry 5i71

View 5i71 on RCSB PDB site
Description: X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site
Class: membrane protein
Keywords: Membrane protein
Deposited on 2016-02-16, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium-dependent serotonin transporter
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC6A4, HTT, SERT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31645 (2-End)
      • cloning artifact (0-1)
      • engineered mutation (217)
      • engineered mutation (365)
      • engineered mutation (480)
      • engineered mutation (506)
  • Chain 'B':
    Compound: 8B6 antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I71 (0-End)
  • Chain 'C':
    Compound: 8B6 antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I71 (0-213)
    Domains in SCOPe 2.07: d5i71c1, d5i71c2
  • Heterogens: 68P, NAG, CLR, D12, HEX, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i71C (C:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhysiprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec