PDB entry 5i70

View 5i70 on RCSB PDB site
Description: crystal structure of plasmepsin iv
Deposited on 2016-02-16, released 2016-03-09
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin IV
    Species: Plasmodium falciparum (isolate 7G8) [TaxId:57266]
    Gene: PFBG_05102
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: plasmepsin IV
    Species: Plasmodium falciparum (isolate 7G8) [TaxId:57266]
    Gene: PFBG_05102
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: pepstatin A
    Species: Actinomyces, synthetic [TaxId:1654]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I70
  • Chain 'D':
    Compound: pepstatin A
    Species: Actinomyces, synthetic [TaxId:1654]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I70 (0-5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i70A (A:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl
    

    Sequence, based on observed residues (ATOM records):
    >5i70A (A:)
    sielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlydasask
    syekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsefdgil
    glgwkdlsigsidpvvvelkkqnkidnalftfylpvhdhvgyltiggiesdfyegpltye
    klnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffvikvpfyvttcdnd
    dlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfilgdpfmrkyftv
    fdyekesvgfavakn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i70B (B:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl
    

    Sequence, based on observed residues (ATOM records):
    >5i70B (B:)
    sielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlydasask
    syekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsefdgil
    glgwkdlsigsidpvvvelkkqnkidnalftfylpvhdvgyltiggiesdfyegpltyek
    lnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvpflplyv
    ttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfilgdpfm
    rkyftvfdyekesvgfavakn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5i70C (C:)
    xvvxax
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5i70D (D:)
    xvvxax