PDB entry 5i6j

View 5i6j on RCSB PDB site
Description: crystal structure of srgap2 f-barx
Deposited on 2016-02-16, released 2017-03-08
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SLIT-ROBO Rho GTPase-activating protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SRGAP2, ARHGAP34, FNBP2, KIAA0456, SRGAP2A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i6jA (A:)
    mtspakfkkdkeiiaeydtqvkeiraqlteqmkcldqqcelrvqllqdlqdffrkkaeie
    mdysrnleklaerflaktrstkdqqfkkdqnvlspvncwnlllnqvkresrdhttlsdiy
    lnniiprfvqvsedsgrlfkkskevgqqlqddlmkvlnelysvmktyhmynadsisaqsk
    lkeaekqeekqigksvkqedrqtprspdstanvrieekhvrrssvkkiekmkekrqakyt
    enklkaikarneyllaleatnasvfkyyihdlsdlidqccdlgyhaslnralrtflsael
    nleqskhegldaienavenldatsdkqrlmemynnvfcppmkfefqphmgdmasqlcaqq
    pvqselvqrcqqlqsrlstlkieneevkktmeatlqtiqdivtvedfdvsdcfqysnsme
    svkstvsetfmskpsiakrranqqeteqfyftkmkeylegrnlitklqakhdllqktlge
    sqrt
    

    Sequence, based on observed residues (ATOM records):
    >5i6jA (A:)
    kkdkeiiaeydtqvkeiraqlteqmkcldqqcelrvqllqdlqdffrkkaeiemdysrnl
    eklaerflaktqnvlspvncwnlllnqvkresrdhttlsdiylnniiprfvqvsedsgrl
    fkkskevgqqlqddlmkvlnelysvmktyhmynadsisaqsklkeaekqevkkiekmkek
    rqakytenklkaikarneyllaleatnasvfkyyihdlsdlidqccdlgyhaslnralrt
    flsaelnleqskhegldaienavenldatsdkqrlmemynnvfcppmkfefqphmgdmas
    qlcaqqpvqselvqrcqqlqsrlstlkieneevkktmeatlqtiqdivtvedfdvsdcfq
    ykpsiakrranqqeteqfyftkmkeylegrnlitklqakhdllqktlges