PDB entry 5i6f

View 5i6f on RCSB PDB site
Description: crystal structure of c-terminal variant 1 of chaetomium thermophilum acetyl-coa carboxylase
Deposited on 2016-02-16, released 2016-04-20
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA carboxylase-like protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0021690
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0S3L5 (Start-1151)
    • PDB 5I6F (1152-1174)
  • Chain 'B':
    Compound: Acetyl-CoA carboxylase-like protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0021690
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0S3L5 (Start-1151)
    • PDB 5I6F (1152-1178)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i6fA (A:)
    gnlrevryhdeerpyfidwdfalrksganqtessmhmqsvvpsspatpvendfkrihsis
    dmtylarrtrdepirkgvivpckdlldaeealsralevlplahketkdkdrkqqpgiaad
    laqrrrpgtplrlegigelsavvnvavrdaegkndeeilalikpwvqnskadllarrvrr
    ltficgrndgsypsyytfrgpdyaeddsirhiepslafqlelgrlskfkltpvftqnkni
    hvyeavgrgvetdrryftravvrpgrlrdeistaeyliseadrvvndifdaleiigtnkt
    dlnhmfinfshtfqvtadevaeslqgfldrfgprgwrlrvhqveirincmrsdnndendt
    mplrviitntsgfviqielyeeklsekgewvyyyvsgnakigsmhllpvstpyptknwlq
    pkrykahilgtqyvydfpelfrqaiqnswteavkkipslaakqpaigecidynelvlgdq
    dnlaevsrepgmnstgmvgwlinartpeypdgrkfivvanditfkigsfgpkedtfffkc
    telarkmgipriylsansgarlglaeelmphfnvawndpakpeagfkylylsdeakrrfe
    neviteeivedgekrhkiitivgaeeglgveclrgsgliagatsrayndiftctlvtcrs
    vgigaylvrlgqravqvegqpiiltgapalnsllgrevytsnlqlggtqimyrngvshlt
    akddfdgvtkivqwlsfipdqrnnplpilspspdpwdrdvvytppykqtydvrwmiagke
    dedgfqpglfdkdsfvetlggwartvvvgrarlggipmgviavetrtienitpadpanpd
    sieqvtneaggvwypnsafktaqaindfnygeqlplmilanwrgfsggqrdmynevlkyg
    sfivdaltrfekpifiyipphgelrggswvvvdptinpasmemyadeearggvlepegii
    pikykkdkqletmarldpvyrslkkemakeglskeesdnikkkmqqreelllpiyhqicv
    qfadlhdragrmkakgvirqslqwrqsrrffywrvrrrlieddilrrieeainpagkrrh
    dpentslaaspetrsphlvqleswvgipgfktndrevvewyeqnqdrinekleklkkesi
    adqmrellraaexxxxxxxxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >5i6fA (A:)
    irkgvivpckdlldaeealsralevlpavvnvavrdaegkndeeilalikpwvqnskadl
    larrvrrltficgrndgsypsyytfrgpdyaeddsirhiepslafqlelgrlskfkltpv
    ftqnknihvyeavgrgvetdrryftravvrpgrlaeyliseadrvvndifdaleiigtnk
    tdlnhmfinfshtfqvtadevaeslqgfldrfgprgwrlrvhqveirincmrsendtmpl
    rviitntsgfviqielyeeklsekgewvyyyvsgnakigsmhllpvstpyptknwlqpkr
    ykahilgtqyvydfpelfrqaiqnswteavkkipslaakqpaigecidynelvlgdqdnl
    aevsrepgmnstgmvgwlinartpeypdgrkfivvanditfkigsfgpkedtfffkctel
    arkmgipriylsansgarlglaeelmphfnvawndpakpeagfkylylsdeakrrfenev
    iteeivedgekrhkiitivgaeeglgveclrgsgliagatsrayndiftctlvtcrsvgi
    gaylvrlgqravqvegqpiiltgapalnsllgrevytsnlqlggtqimyrngvshltakd
    dfdgvtkivqwlsfipdqrnnplpilspspdpwdrdvvytppykqtydvrwmiagkeded
    gfqpglfdkdsfvetlggwartvvvgrarlggipmgviavetrtienitpadpanpdsie
    qvtneaggvwypnsafktaqaindfnygeqlplmilanwrgfsggqrdmynevlkygsfi
    vdaltrfekpifiyipphgelrggswvvvdptinpasmemyadeearggvlepegiipik
    ykkdkqletmarldpvyrslkkemakeglskeesdnikkkmqqreelllpiyhqicvqfa
    dlhdragrmkakgvirqslqwrqsrrffywrvrrrlieddilrrieeainpantslaasp
    etrsphlvqleswvgipgfktndrevvewyeqnqdrinekleklkkesiadqmrellraa
    exxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i6fB (B:)
    gnlrevryhdeerpyfidwdfalrksganqtessmhmqsvvpsspatpvendfkrihsis
    dmtylarrtrdepirkgvivpckdlldaeealsralevlplahketkdkdrkqqpgiaad
    laqrrrpgtplrlegigelsavvnvavrdaegkndeeilalikpwvqnskadllarrvrr
    ltficgrndgsypsyytfrgpdyaeddsirhiepslafqlelgrlskfkltpvftqnkni
    hvyeavgrgvetdrryftravvrpgrlrdeistaeyliseadrvvndifdaleiigtnkt
    dlnhmfinfshtfqvtadevaeslqgfldrfgprgwrlrvhqveirincmrsdnndendt
    mplrviitntsgfviqielyeeklsekgewvyyyvsgnakigsmhllpvstpyptknwlq
    pkrykahilgtqyvydfpelfrqaiqnswteavkkipslaakqpaigecidynelvlgdq
    dnlaevsrepgmnstgmvgwlinartpeypdgrkfivvanditfkigsfgpkedtfffkc
    telarkmgipriylsansgarlglaeelmphfnvawndpakpeagfkylylsdeakrrfe
    neviteeivedgekrhkiitivgaeeglgveclrgsgliagatsrayndiftctlvtcrs
    vgigaylvrlgqravqvegqpiiltgapalnsllgrevytsnlqlggtqimyrngvshlt
    akddfdgvtkivqwlsfipdqrnnplpilspspdpwdrdvvytppykqtydvrwmiagke
    dedgfqpglfdkdsfvetlggwartvvvgrarlggipmgviavetrtienitpadpanpd
    sieqvtneaggvwypnsafktaqaindfnygeqlplmilanwrgfsggqrdmynevlkyg
    sfivdaltrfekpifiyipphgelrggswvvvdptinpasmemyadeearggvlepegii
    pikykkdkqletmarldpvyrslkkemakeglskeesdnikkkmqqreelllpiyhqicv
    qfadlhdragrmkakgvirqslqwrqsrrffywrvrrrlieddilrrieeainpagkrrh
    dpentslaaspetrsphlvqleswvgipgfktndrevvewyeqnqdrinekleklkkesi
    adqmrellraaexxxxxxxxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >5i6fB (B:)
    irkgvivpckdlldaeealsralevlpavvnvavrdaegkndeeilalikpwvqnskadl
    larrvrrltficgrndgsypsyytfrgpdyaeddsirhiepslafqlelgrlskfkltpv
    ftqnknihvyeavgrgvetdrryftravvrpgrlaeyliseadrvvndifdaleiigtnk
    tdlnhmfinfshtfqvtadevaeslqgfldrfgprgwrlrvhqveirincmrsendtmpl
    rviitntsgfviqielyeeklsekgewvyyyvsgnakigsmhllpvstpyptknwlqpkr
    ykahilgtqyvydfpelfrqaiqnswteavkkipslaakqpaigecidynelvlgdqdnl
    aevsrepgmnstgmvgwlinartpeypdgrkfivvanditfkigsfgpkedtfffkctel
    arkmgipriylsansgarlglaeelmphfnvawndpakpeagfkylylsdeakrrfenev
    iteeivedgekrhkiitivgaeeglgveclrgsgliagatsrayndiftctlvtcrsvgi
    gaylvrlgqravqvegqpiiltgapalnsllgrevytsnlqlggtqimyrngvshltakd
    dfdgvtkivqwlsfipdqrnnplpilspspdpwdrdvvytppykqtydvrwmiagkeded
    gfqpglfdkdsfvetlggwartvvvgrarlggipmgviavetrtienitpadpanpdsie
    qvtneaggvwypnsafktaqaindfnygeqlplmilanwrgfsggqrdmynevlkygsfi
    vdaltrfekpifiyipphgelrggswvvvdptinpasmemyadeearggvlepegiipik
    ykkdkqletmarldpvyrslkkemakeglskeesdnikkkmqqreelllpiyhqicvqfa
    dlhdragrmkakgvirqslqwrqsrrffywrvrrrlieddilrrieeainpantslaasp
    etrsphlvqleswvgipgfktndrevvewyeqnqdrinekleklkkesiadqmrellraa
    exxxxxxxxxxxxxxxxxxxxxxxxxxx