PDB entry 5i67

View 5i67 on RCSB PDB site
Description: Crystal Structure Analysis of MTB PEPCK mutant C273S
Class: lyase
Keywords: PEPCK, mutant C273S, LYASE
Deposited on 2016-02-16, released 2016-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis H37Ra [TaxId:419947]
    Gene: pckG, MRA_0219
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TYT6 (Start-604)
      • engineered mutation (271)
    Domains in SCOPe 2.06: d5i67a1, d5i67a2
  • Heterogens: GDP, PEG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i67A (A:)
    tsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirl
    npekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmr
    grtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalh
    svgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamah
    degwlaehmlilklispenkayyfaaafpsasgktnlamlqptipgwraetlgddiawmr
    fgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwwegleg
    dpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrr
    kttvplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhw
    inlgkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpig
    tvpavedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdal
    kerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i67A (A:)
    gldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhk
    nsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyv
    vpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgapl
    epgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdegwla
    ehmlilklispenkayyfaaafpsasgktnlamlqptipgwraetlgddiawmrfgkdgl
    yavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpqhlid
    wkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrkttvplv
    teardwqhgvfigatlgsenvrrdpmamlpflgynvgdyfqhwinlgkhadesklpkvff
    vnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpavedldldgldvda
    advaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg