PDB entry 5i66

View 5i66 on RCSB PDB site
Description: X-ray structure of the Fab fragment of 8B6, a murine monoclonal antibody specific for the human serotonin transporter
Class: immune system
Keywords: Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2016-02-16, released 2016-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8B6 antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I66 (0-End)
    Domains in SCOPe 2.08: d5i66a_
  • Chain 'B':
    Compound: 8B6 antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I66 (0-End)
    Domains in SCOPe 2.08: d5i66b1, d5i66b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i66A (A:)
    evqlqqsgpelvkpgasvkisckasgytftdyymnwvkqshgkslewigninpnnggtsy
    nqkfkgkatltvdkssttaymelrsltsedsavyyctrspvrpyyfdywgqgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i66A (A:)
    evqlqqsgpelvkpgasvkisckasgytftdyymnwvkqshgkslewigninpnnggtsy
    nqkfkgkatltvdkssttaymelrsltsedsavyyctrspvrpyyfdywgqgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkklep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i66B (B:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhysiprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i66B (B:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhysiprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne