PDB entry 5i65

View 5i65 on RCSB PDB site
Description: porcine reproductive and respiratory syndrome virus nonstructural protein 7 alpha (nsp7 alpha)
Deposited on 2016-02-16, released 2017-02-22
The last revision was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonstructural proteins ORF1a
    Species: Porcine reproductive and respiratory syndrome virus [TaxId:28344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QDR1 (1-149)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5i65A (A:)
    gsltgalamrlndedldfltkwtdfkcfvsasnmrnaagqfieaayakalrielaqlvqv
    dkvrgtlakleafadtvapqlspgdivvalghtpvggifdlkvgstkhtlqaietrvlag
    skmtvarvvdptptpppapvpiplppkvle