PDB entry 5i5u

View 5i5u on RCSB PDB site
Description: x-ray crystal structure at 2.40a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a tetrahydronaphthalenyl compound and an internal aldimine linked plp cofactor.
Class: transferase
Keywords: fold type IV, transferase
Deposited on 2016-02-15, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Branched-chain-amino-acid aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: BCAT2, BCATM, BCT2, ECA40
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i5ua_
  • Chain 'B':
    Compound: Branched-chain-amino-acid aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: BCAT2, BCATM, BCT2, ECA40
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i5ub_
  • Heterogens: PLP, 67Y, CL, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i5uA (A:)
    gshmasssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpf
    qnltlhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdkle
    llecirrlievdkdwvpdaagtslyvrpvlignepslgvsqptrallfvilcpvgayfpg
    gsvtpvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqlt
    evgtmnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkql
    lraleegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygi
    rahewmfpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i5uA (A:)
    ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
    passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
    rlievdkdwvpdaagtslyvrpvlignepslgvsqptrallfvilcpvgayfpggsvtpv
    slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
    ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
    grvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
    fpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i5uB (B:)
    gshmasssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpf
    qnltlhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdkle
    llecirrlievdkdwvpdaagtslyvrpvlignepslgvsqptrallfvilcpvgayfpg
    gsvtpvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqlt
    evgtmnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkql
    lraleegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygi
    rahewmfpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i5uB (B:)
    ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
    passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
    rlievdkdwvpdaagtslyvrpvlignepslgvsqptrallfvilcpvgayfsvtpvsll
    adpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmnifv
    ywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllraleegrv
    revfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewmfpv