PDB entry 5i5n

View 5i5n on RCSB PDB site
Description: crystal structure of n-terminal domain of matrix protein of thogoto virus at acidic ph.
Deposited on 2016-02-15, released 2016-08-17
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix protein
    Species: THOGOTO VIRUS [TaxId:11569]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: matrix protein
    Species: THOGOTO VIRUS [TaxId:11569]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i5nA (A:)
    gplgssnlpvrsfsevccaearaaiiqmennpdetvcnriwkihrdlqssdltttvqvmm
    vyrfiskrvpegcfailsgvntgmynprelkrsyvqslssgtsceflrsldklaknllav
    hvcsdvkmslnkrqvidfisgeedptlhtaehlt
    

    Sequence, based on observed residues (ATOM records):
    >5i5nA (A:)
    nlpvrsfsevccaearaaiiqmennpdetvcnriwkihrdlqssdltttvqvmmvyrfis
    krvpegcfailsgvntgmynprelkrsyvqslssgtsceflrsldklaknllavhvcsdv
    kmslnkrqvidfisge
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i5nB (B:)
    gplgssnlpvrsfsevccaearaaiiqmennpdetvcnriwkihrdlqssdltttvqvmm
    vyrfiskrvpegcfailsgvntgmynprelkrsyvqslssgtsceflrsldklaknllav
    hvcsdvkmslnkrqvidfisgeedptlhtaehlt
    

    Sequence, based on observed residues (ATOM records):
    >5i5nB (B:)
    nlpvrsfsevccaearaaiiqmennpdetvcnriwkihrdlqssdltttvqvmmvyrfis
    krvpegcfailsgvntgmynprelkrsyvqslssgtsceflrsldklaknllavhvcsdv
    kmslnkrqvidfisge