PDB entry 5i5e

View 5i5e on RCSB PDB site
Description: Crystal Structure of Transketolase mutants-H66/261C complex with xylulose-5-phoaphate from Pichia Stipitis
Class: transferase
Keywords: Transketolase, xylulose-5-phosphate, TRANSFERASE
Deposited on 2016-02-15, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34736 (Start-696)
      • engineered mutation (85)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d5i5ea1, d5i5ea2, d5i5ea3
  • Heterogens: TPP, 5SP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i5eA (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsngcacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvcgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltrqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i5eA (A:)
    ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv
    lsngcacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic
    ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf
    wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl
    vrltttigfgslaqgthgvcgaplkaddikqlktkwgfnpeesfavpaevtasynehvae
    nqkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklsei
    vlskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgai
    mngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpi
    etlahfratpnisvwrpadgnetsaayksaiesthtphilaltrqnlpqlegssiekask
    ggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeykls
    vlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktv
    afykgkdvvsplrsaf