PDB entry 5i5c

View 5i5c on RCSB PDB site
Description: x-ray crystal structure of allo-thr31-shk
Deposited on 2016-02-15, released 2017-01-25
The last revision was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kappa-stichotoxin-She3a
    Species: Stichodactyla helianthus, synthetic [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Kappa-stichotoxin-She3a
    Species: Stichodactyla helianthus, synthetic [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Kappa-stichotoxin-She3a
    Species: Stichodactyla helianthus, synthetic [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, LI, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5i5cA (A:)
    rscidtipksrctafqckhsmkyrlsfcrktcgtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5i5cB (B:)
    rscidtipksrctafqckhsmkyrlsfcrktcgtc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5i5cC (C:)
    rscidtipksrctafqckhsmkyrlsfcrktcgtc