PDB entry 5i58

View 5i58 on RCSB PDB site
Description: glutamate- and glycine-bound glun1/glun2a agonist binding domains with mpx-004
Class: transport protein, receptor
Keywords: NMDA receptor, Antagonist, TRANSPORT PROTEIN, RECEPTOR
Deposited on 2016-02-14, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grin1, Nmdar1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35439 (Start-151)
      • linker (152-153)
    • Uniprot P35439 (154-End)
    Domains in SCOPe 2.07: d5i58a_
  • Chain 'B':
    Compound: Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grin2a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00959 (Start-138)
      • linker (139-140)
    • Uniprot Q00959 (141-280)
      • see remark 999 (238)
    Domains in SCOPe 2.07: d5i58b_
  • Heterogens: GLY, GLU, 67R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i58A (A:)
    gmstrlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvp
    qccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadm
    ivapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqss
    vdiyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvt
    tgelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i58A (A:)
    strlkivtihqepfvyvkptmsdgtcvkkvictgpvpqccygfcidlliklartmnftye
    vhlvadgkfgtqervkewngmmgellsgqadmivapltinneraqyiefskpfkyqglti
    lvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmekhnyesaae
    aiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrkdspwkqnvslsi
    lkshengfmedldktwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i58B (B:)
    sddnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfc
    idilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineerse
    vvdfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnyp
    ymhqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifatt
    gygialqkgspwkrqidlallqfvgdgemeeletlwltgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i58B (B:)
    dnhlsivtleeapfvivedidpetcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
    kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
    svpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
    ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
    alqkgspwkrqidlallqfvgdgemeeletlwltgic