PDB entry 5i4t

View 5i4t on RCSB PDB site
Description: immature hexagonal lattice of hiv-1 gag
Deposited on 2016-02-12, released 2016-07-27
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 3.27 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q699C3
      • conflict (72)
  • Chain 'H':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q699C3
      • conflict (72)
  • Chain 'I':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q699C3
      • conflict (72)
  • Chain 'J':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q699C3
      • conflict (72)
  • Chain 'K':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q699C3
      • conflict (72)
  • Chain 'L':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q699C3
      • conflict (72)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5i4tG (G:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records):
    >5i4tG (G:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5i4tH (H:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records):
    >5i4tH (H:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5i4tI (I:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records):
    >5i4tI (I:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5i4tJ (J:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records):
    >5i4tJ (J:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5i4tK (K:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records):
    >5i4tK (K:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5i4tL (L:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records):
    >5i4tL (L:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv