PDB entry 5i4q

View 5i4q on RCSB PDB site
Description: Contact-dependent inhibition system from Escherichia coli NC101 - ternary CdiA/CdiI/EF-Tu complex (domains 2 and 3)
Class: toxin/antitoxin
Keywords: toxin, antitoxin, elongation factor, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structure-Function Analysis of Polymorphic CDI Toxin-Immunity Protein Complexes, UC4CDI, TOXIN-ANTITOXIN complex
Deposited on 2016-02-12, released 2017-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Contact-dependent inhibitor A
    Species: Escherichia coli NC101 [TaxId:753642]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I4Q (Start-91)
  • Chain 'B':
    Compound: Contact-dependent inhibitor I
    Species: Escherichia coli NC101 [TaxId:753642]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I4Q (0-End)
  • Chain 'C':
    Compound: elongation factor tu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5i4qc1, d5i4qc2
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5i4qC (C:)
alegdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergii
kvgeeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpg
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

    Sequence, based on observed residues (ATOM records): (download) 
    >5i4qC (C:)
kpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkllde
gragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyr
pqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagv
vakvlg