PDB entry 5i4d

View 5i4d on RCSB PDB site
Description: 1.75 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
Class: immune system
Keywords: Superantigen-like protein, Sialyl-LewisX, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, IMMUNE SYSTEM
Deposited on 2016-02-11, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superantigen-like protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: set9, ERS445052_00332, RL02_05830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4da1, d5i4da2
  • Chain 'B':
    Compound: Superantigen-like protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: set9, ERS445052_00332, RL02_05830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4db1, d5i4db2
  • Heterogens: NDG, FUC, GAL, SIA, PGE, PG4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i4dA (A:)
    mgsshhhhhhenlyfqgekiqstkvdkvptlkaerlaminitagansattqaantrqert
    pklekapntneektsaskiekisqpkqeeqktlnisatpapkqeqsqtttesttpktkvt
    tppstntpqpmqstksdtpqsptikqaqtdmtpkyedlrayytkpsfefekqfgfmlkpw
    ttvrfmnvipnrfiykialvgkdekkykdgpydnidvfivlednkyqlkkysvggitktn
    skkvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgs
    gtivikmknggkytfelhkklqehrmadvidgtnidnievnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4dA (A:)
    tpkyedlrayytkpsfefekqfgfmlkpwttvrfmnvipnrfiykialvgkdekkykdgp
    ydnidvfivlednkyqlkkysvggitktnskkvnhkvelsitkkdnqgmisrdvseymit
    keeislkeldfklrkqliekhnlygnmgsgtivikmknggkytfelhkklqehrmadvid
    gtnidnievnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i4dB (B:)
    mgsshhhhhhenlyfqgekiqstkvdkvptlkaerlaminitagansattqaantrqert
    pklekapntneektsaskiekisqpkqeeqktlnisatpapkqeqsqtttesttpktkvt
    tppstntpqpmqstksdtpqsptikqaqtdmtpkyedlrayytkpsfefekqfgfmlkpw
    ttvrfmnvipnrfiykialvgkdekkykdgpydnidvfivlednkyqlkkysvggitktn
    skkvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgs
    gtivikmknggkytfelhkklqehrmadvidgtnidnievnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4dB (B:)
    mtpkyedlrayytkpsfefekqfgfmlkpwttvrfmnvipnrfiykialvgkdekkykdg
    pydnidvfivlednkyqlkkysvggitktnskkvnhkvelsitkkdnqgmisrdvseymi
    tkeeislkeldfklrkqliekhnlygnmgsgtivikmknggkytfelhkklqehrmadvi
    dgtnidnievnik