PDB entry 5i49

View 5i49 on RCSB PDB site
Description: rna editing tutase 1 from trypanosoma brucei in complex with utp analog umpnpp
Deposited on 2016-02-11, released 2016-11-09
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3' terminal uridylyl transferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: 3' TUTase
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, 2KH, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i49A (A:)
    mgvrlyscdacphavftthaallahaeehhadllpdharlrriaqklnpvwnralnarrn
    titswgkkifhvaaqrdageskmqeahraraqlecvvrrwhdkarvfifgssvamgvwdg
    tadidfavvdvdamergswppleknavrsitellrrvgfsfvnlepisharvpiikhhas
    spiltvarrdaedvvarsirfilngpatredrlllegsvrdavgptgvqqvwwnrtsdmm
    satlesttaavraamcspalasaslrtkvqpahdecrpelynidfdlsfrafgirnstll
    rkyllshpcarpgaivlkdwsktsgvnnsvngyftsyainimwiyylvqkgyvpyvdple
    ipeslvnytdfdprytpmidpeitntereelykaagdmlvgffyfysfefdwghnvisln
    rpgittkrmlgwhvedvvpvastsvssggggsnvkrhptryelciedpyeenlnlgrhig
    vtkslrvrtelyrgllsllkegetrscvfaaa
    

    Sequence, based on observed residues (ATOM records):
    >5i49A (A:)
    vrlyscdacphavftthaallahaeehhadllpdharlrriaqklnpvwnralnarrnti
    tswgkkifhvaaqrdageskmqeahraraqlecvvrrwhdkarvfifgssvamgvwdgta
    didfavvdvdamergswppleknavrsitellrrvgfsfvnlepisharvpiikhhassp
    dvvarsirfilngpatredrlllegsvrdavgptgvqqvwwnrtsdmmsatlesttaavr
    aamcspalasaslrtkvqpahdecrpelynidfdlsfrafgirnstllrkyllshpcarp
    gaivlkdwsktsgvnnsvngyftsyainimwiyylvqkgyvpyvdpleipeslvnytdfd
    prytpmidpeitntereelykaagdmlvgffyfysfefdwghnvislnrpgittkrmlgw
    hvedvhptryelciedpyeenlnlgrhigvtkslrvrtelyrgllsllkeg