PDB entry 5i3e

View 5i3e on RCSB PDB site
Description: crystal structure of putative putative deoxyribonuclease-2 from burkholderia thailandensis, e264
Deposited on 2016-02-10, released 2017-02-15
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative deoxyribonuclease-2
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_II0389
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative deoxyribonuclease-2
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_II0389
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i3eA (A:)
    mahhhhhhmaisprdeqnrsvdlwfaykvpkltkdadsdsasgyeyvyydrqvgavqksp
    nlmndpkgalfytldsvfgdpgdttgwilyndempadanrsnnatlghtkgviafdiass
    salwllhswpkyaspsvpgvptplygqtflclsldlatagklaaqmalhqqpqvylprtg
    gldhtsplyaltqplnasapgdsdsldfktrggvpfkviaknrkwgkdfwndlvgptlka
    dmyvetwirgkippvldsdgvhktydikfidlrklgapwawpetqdhakwgitttdnwvc
    vgdinrmvtqekrgggtiafqdpklwkalcetdliipppgktdaqaramirkthepae
    

    Sequence, based on observed residues (ATOM records):
    >5i3eA (A:)
    maisprdeqnrsvdlwfaykvpkltkdadsdsasgyeyvyydrqvgavqkspnlmndpkg
    alfytldsvfgdpgdttgwilyndempadanrsnnatlghtkgviafdiasssalwllhs
    wpkyaspsvvptplygqtflclsldlatagklaaqmalhqqpqvylprtggldhtsplya
    ltqplnasapgdsdsldfktrggvpfkviaknrkwgkdfwndlvgptlkadmyvetwirg
    kippvldsdgvhktydikfidlrklgapwawpetqdhakwgitttdnwvcvgdinrmvtq
    ekrgggtiafqdpklwkalcetdliipppgktdaqaramirkthep
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i3eB (B:)
    mahhhhhhmaisprdeqnrsvdlwfaykvpkltkdadsdsasgyeyvyydrqvgavqksp
    nlmndpkgalfytldsvfgdpgdttgwilyndempadanrsnnatlghtkgviafdiass
    salwllhswpkyaspsvpgvptplygqtflclsldlatagklaaqmalhqqpqvylprtg
    gldhtsplyaltqplnasapgdsdsldfktrggvpfkviaknrkwgkdfwndlvgptlka
    dmyvetwirgkippvldsdgvhktydikfidlrklgapwawpetqdhakwgitttdnwvc
    vgdinrmvtqekrgggtiafqdpklwkalcetdliipppgktdaqaramirkthepae
    

    Sequence, based on observed residues (ATOM records):
    >5i3eB (B:)
    maisprdeqnrsvdlwfaykvpkltkdadsdsasgyeyvyydrqvgavqkspnlmndpkg
    alfytldsvfgdpgdttgwilyndempadanrsnnatlghtkgviafdiasssalwllhs
    wpkyaspsvpgvptplygqtflclsldlatagklaaqmalhqqpqvylprtggldhtspl
    yaltqplnasapgdsdsldfktrggvpfkviaknrkwgkdfwndlvgptlkadmyvetwi
    rgkippvldsdgvhktydikfidlrklgapwawpetqdhakwgitttdnwvcvgdinrmv
    tqekrgggtiafqdpklwkalcetdliipppgktdaqaramirkthep