PDB entry 5i3d

View 5i3d on RCSB PDB site
Description: Sulfolobus solfataricus beta-glycosidase - E387Y mutant
Class: hydrolase
Keywords: Glycosidase, HYDROLASE
Deposited on 2016-02-10, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (Start-488)
      • conflict (386)
    Domains in SCOPe 2.06: d5i3da_
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (Start-488)
      • conflict (386)
    Domains in SCOPe 2.06: d5i3db_
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (Start-488)
      • conflict (386)
    Domains in SCOPe 2.06: d5i3dc_
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (Start-488)
      • conflict (386)
    Domains in SCOPe 2.06: d5i3dd_
  • Heterogens: PE8, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i3dA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i3dA (A:)
    sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
    yktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrldeya
    nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
    farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
    haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
    ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
    ffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgy
    lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
    pvkplrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i3dB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i3dB (B:)
    sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
    yktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrldeya
    nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
    farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
    haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
    ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
    ffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgy
    lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
    pvkplrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5i3dC (C:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i3dC (C:)
    sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
    yktfhdnaqkmglkiarlnvewsrifpnplpdvteveinenelkrldeyankdalnhyre
    ifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvyefarfsayiaw
    kfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqaharaydgiks
    vskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgnekivrddlkg
    rldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffpeglydvl
    tkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgylhwsladnye
    wasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvkplrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5i3dD (D:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i3dD (D:)
    sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
    yktfhdnaqkmglkiarlnvewsrifpnplpdvteveinenelkrldeyankdalnhyre
    ifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvyefarfsayiaw
    kfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqaharaydgiks
    vskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgnekivrddlkg
    rldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffpeglydvl
    tkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgylhwsladnye
    wasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvkplrh