PDB entry 5i35

View 5i35 on RCSB PDB site
Description: structure of the human mitochondrial kinase coq8a r611k with amppnp (cerebellar ataxia and ubiquinone deficiency through loss of unorthodox kinase activity)
Deposited on 2016-02-09, released 2016-08-17
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Atypical kinase ADCK3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCK3, CABC1, PP265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NI60
      • engineered mutation (356)
  • Heterogens: ANP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i35A (A:)
    sseanaerivrtlckvrgaalklgqmlsiqddafinphlakifervrqsadfmplkqmmk
    tlnndlgpnwrdkleyfeerpfaaasigqvhlarmkggrevamkiqypgvaqsinsdvnn
    lmavlnmsnmlpeglfpehlidvlrrelalecdyqreaacarkfrdllkghpffyvpeiv
    delcsphvlttelvsgfpldqaeglsqeirneicynilvlclrelfefhfmqtdpnwsnf
    fydpqqhkvalldfgatreydrsftdlyiqiiraaadrdretvraksiemkfltgyevkv
    medahldaililgeafasdepfdfgtqsttekihnlipvmlrhrlvpppeetyslhkkmg
    gsflicsklkarfpckamfeeaysnyckrqaqq
    

    Sequence, based on observed residues (ATOM records):
    >5i35A (A:)
    erivrtlckvrgaalklgqmlsiqddafinphlakifervrqsadfmplkqmmktlnndl
    gpnwrdkleyfeerpfaaasigqvhlarmkggrevamkiqypgvaqsinsdvnnlmavln
    msnmlpeglfpehlidvlrrelalecdyqreaacarkfrdllkghpffyvpeivdelcsp
    hvlttelvsgfpldqaeglsqeirneicynilvlclrelfefhfmqtdpnwsnffydpqq
    hkvalldfgatreydrsftdlyiqiiraaadrdretvraksiemkfltgyevkvmedahl
    daililgeafasdepfdfgtqsttekihnlipvmlrhrlvpppeetyslhkkmggsflic
    sklkarfpckamfeeaysnyckrq