PDB entry 5i32

View 5i32 on RCSB PDB site
Description: ammonia permeable aquaporin attip2;1
Deposited on 2016-02-09, released 2016-04-06
The last revision was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aquaporin TIP2-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TIP2-1, At3g16240, MYA6.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41951 (26-End)
      • expression tag (25)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i32A (A:)
    mshhhhhhhhhhdsngiptenlyfqgagvafgsfddsfslaslraylaefistllfvfag
    vgsaiayakltsdaaldtpglvaiavchgfalfvavaiganisgghvnpavtfglavggq
    itvitgvfywiaqllgstaacfllkyvtgglavpthsvaaglgsiegvvmeiiitfalvy
    tvyataadpkkgslgtiaplaiglivganilaagpfsggsmnparsfgpavaagdfsghw
    vywvgpliggglagliygnvfmgssehvplasadf
    

    Sequence, based on observed residues (ATOM records):
    >5i32A (A:)
    gagvafgsfddsfslaslraylaefistllfvfagvgsaiayakltsdaaldtpglvaia
    vchgfalfvavaiganisgghvnpavtfglavggqitvitgvfywiaqllgstaacfllk
    yvtgglavpthsvaaglgsiegvvmeiiitfalvytvyataadpkkgslgtiaplaigli
    vganilaagpfsggsmnparsfgpavaagdfsghwvywvgpliggglagliygnvfmg