PDB entry 5i2l

View 5i2l on RCSB PDB site
Description: structure of ef-hand containing protein
Deposited on 2016-02-09, released 2016-12-28
The last revision was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EF-hand domain-containing protein D2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFHD2, SWS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i2lA (A:)
    gamgsgepqspsrrvfnpytefkefsrkqikdmekmfkqydagrdgfidlmelklmmekl
    gapqthlglknmikevdedfdsklsfrefllifrkaaagelqedsglcvlarlseidvss
    

    Sequence, based on observed residues (ATOM records):
    >5i2lA (A:)
    fnpytefkefsrkqikdmekmfkqydagrdgfidlmelklmmeklgapqthlglknmike
    vdedfdsklsfrefllifrkaaagelqedsglcvlarlseidvss