PDB entry 5i29

View 5i29 on RCSB PDB site
Description: taf1(2) bound to a pyrrolopyridone compound
Deposited on 2016-02-08, released 2016-06-08
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF1, BA2R, CCG1, CCGS, TAF2A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 67B, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i29A (A:)
    gspllddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletir
    kniskhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltql
    ekdictakeaaleeaelesldpmt
    

    Sequence, based on observed residues (ATOM records):
    >5i29A (A:)
    ddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirknisk
    hkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdic
    takeaaleeaelesldpmt