PDB entry 5i28

View 5i28 on RCSB PDB site
Description: Azurin T30R1, crystal form II
Class: metal binding protein
Keywords: blue copper protein, spin label, metal binding protein
Deposited on 2016-02-08, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28b_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28c_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28d_
  • Chain 'E':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28e_
  • Chain 'F':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28f_
  • Chain 'G':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28g_
  • Chain 'H':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28h_
  • Chain 'I':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28i_
  • Chain 'J':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28j_
  • Chain 'K':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28k_
  • Chain 'L':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28l_
  • Chain 'M':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28m_
  • Chain 'N':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28n_
  • Chain 'O':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28o_
  • Chain 'P':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5i28p_
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28A (A:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28B (B:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28C (C:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28D (D:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28E (E:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28F (F:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28G (G:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28H (H:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28I (I:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28J (J:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28K (K:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28L (L:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28M (M:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28N (N:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28O (O:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i28P (P:)
    aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk