PDB entry 5i23

View 5i23 on RCSB PDB site
Description: crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf022
Deposited on 2016-02-08, released 2016-05-04
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligosaccharide 4-alpha-D-glucosyltransferase
    Species: Cellvibrio japonicus (strain Ueda107) [TaxId:498211]
    Gene: agd31B, CJA_3248
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3PEE6 (Start-792)
      • expression tag (793)
  • Heterogens: PG4, SO4, EDO, 66V, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i23A (A:)
    mnpvkreihpdavfykehklrndglvittnqgnirlqfkseaaievlyradskqlpsfal
    aqpesaikaqltetenhlqfsggtltariqkrpfaisyyrdselllaeesgfqvntdkin
    frfylspgekilgggqrilgmdrrgqrfplynrahygysdhsgqmyfglpaimsskqyil
    vfdnsasgamdigktesdilqleaksgrsayilvagnsypslienftqvtgrqplpprwa
    lgsfasrfgyrseaetratvqkyktedfpldtivldlywfgkdikghmgnldwdkenfpt
    pldmmadfkqqgvktvlitepfvltsskrwddavkakalakdpqgqpkafelyfgnggii
    dvfskegsrwfssiykdlskqgvagwwgdlgepemhpedtqhaigdadtvhnayghrwae
    mlyqqqldqfpelrpfimmragfvgsqrygmipwtgdvsrtwgglasqvelalqmsllgf
    gyihsdlggfadgetldkemyirwlqygvfqpvyrphgqdhipsepvfqdeetkailrpl
    vklryrmlpyiytaayqntltgmplmrplffsdeknpalidnktsyfwgdsllvtpitqa
    gvesvsipapkgvwfdfwkdtryqtdgapltlptdlhtipvlvkagafmpyvpavstted
    yrsdsleihyyadasvplaqgeifeddgkdpnsikrnqfdlltlqathtdnqlhfqlart
    gkgyrgmperrattlvihnasdqyqhldingktiaiaqadcastpalacydqerrqlqlv
    ftwgrealnlrlhkggradpaflykvvinsklegkpipnpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5i23A (A:)
    avfykehklrndglvittnqgnirlqfkseaaievlyradskqlpsfalaqpesaikaql
    tetenhlqfsggtltariqkrpfaisyyrdselllaeesgfqkinfrfylspgekilggg
    qrilgmdrrgqrfplynrahygysdhsgqmyfglpaimsskqyilvfdnsasgamdigkt
    esdilqleaksgrsayilvagnsypslienftqvtgrqplpprwalgsfasrfgyrseae
    tratvqkyktedfpldtivldlywfgkdikghmgnldwdkenfptpldmmadfkqqgvkt
    vlitepfvltsskrwddavkakalakdpqgqpkafelyfgnggiidvfskegsrwfssiy
    kdlskqgvagwwgdlgepemhpedtqhaigdadtvhnayghrwaemlyqqqldqfpelrp
    fimmragfvgsqrygmipwtgdvsrtwgglasqvelalqmsllgfgyihsdlggfadget
    ldkemyirwlqygvfqpvyrphgqdhipsepvfqdeetkailrplvklryrmlpyiytaa
    yqntltgmplmrplffsdeknpalidnktsyfwgdsllvtpitqagvesvsipapkgvwf
    dfwkdtryqtdgapltlptdlhtipvlvkagafmpyvpavsttedyrsdsleihyyadas
    vplaqgeifeddgkdpnsikrnqfdlltlqathtdnqlhfqlartgkgyrgmperrattl
    vihnasdqyqhldingktiaiaqadcastpalacydqerrqlqlvftwgrealnlrlhk