PDB entry 5i1r

View 5i1r on RCSB PDB site
Description: Quantitative characterization of configurational space sampled by HIV-1 nucleocapsid using solution NMR and X-ray scattering
Class: viral protein
Keywords: viral protein
Deposited on 2016-02-05, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: NMR;SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleocapsid protein p7
    Species: Human immunodeficiency virus type 1 (HXB2 ISOLATE) [TaxId:11706]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i1ra_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i1rA (A:)
    mqrgnfrnqrkivkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterqan