PDB entry 5i18

View 5i18 on RCSB PDB site
Description: crystal structure of human germline antibody ighv1-69/igkv4-1
Deposited on 2016-02-05, released 2016-02-24
The last revision was dated 2016-08-03, with a file datestamp of 2016-07-29.
No data on structure quality are available

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I18
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I18 (0-End)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.04, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5i18H (H:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarydgiygeldfwgqgtlvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkschhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5i18H (H:)
    vqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtanya
    qkfqgrvtitadeststaymelsslrsedtavyycarydgiygeldfwgqgtlvtvssas
    tkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
    tvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5i18L (L:)
    mdivmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywast
    resgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records):
    >5i18L (L:)
    mdivmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywast
    resgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrg