PDB entry 5i14

View 5i14 on RCSB PDB site
Description: truncated and mutated t4 lysozyme
Deposited on 2016-02-05, released 2016-02-17
The last revision was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mutated and truncated T4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I14 (0-End)
  • Chain 'B':
    Compound: mutated and truncated T4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I14 (0-End)
  • Heterogens: NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i14A (A:)
    mnifemlridegggsggdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmv
    fqmgetgvagfthslhalqhkhwdhaavhlaksrwynqtpnrakrvittfrtgtwdaykn
    l
    

    Sequence, based on observed residues (ATOM records):
    >5i14A (A:)
    mnifemlridegggsggdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmv
    fqmgetgvagfthslhalqhkhwdhaavhlaksrwynqtpnrakrvittfrtgtwdaykn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i14B (B:)
    mnifemlridegggsggdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmv
    fqmgetgvagfthslhalqhkhwdhaavhlaksrwynqtpnrakrvittfrtgtwdaykn
    l
    

    Sequence, based on observed residues (ATOM records):
    >5i14B (B:)
    mnifemlridegggsggdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmv
    fqmgetgvagfthslhalqhkhwdhaavhlaksrwynqtpnrakrvittfrtgtwdayk