PDB entry 5i12

View 5i12 on RCSB PDB site
Description: Crystal structure of the catalytic domain of MMP-9 in complex with a selective sugar-conjugated arylsulfonamide carboxylate water-soluble inhibitor (DC27).
Class: hydrolase
Keywords: Inhibitor, complex, glycoconjugate, metalloprotease, hydrolase
Deposited on 2016-02-05, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9,Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i12a_
  • Heterogens: ZN, CA, H27, EDO, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i12A (A:)
    dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
    aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal
    gldhssvpealmypmyrftegpplhkddvngirhlyg