PDB entry 5i0t

View 5i0t on RCSB PDB site
Description: Thiosulfate bound Cysteine Dioxygenase at pH 6.8
Class: oxidoreductase
Keywords: cupin-fold, cysteine to cysteine sulfinate, C93-Y157 crosslink, catalysis oxidation, oxidoreductase, thiosulfate
Deposited on 2016-02-04, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i0ta_
  • Heterogens: FE, THJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i0tA (A:)
    mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
    sertlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmt
    fhskfgirtpfttsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i0tA (A:)
    ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
    lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
    fgirtp