PDB entry 5i0q

View 5i0q on RCSB PDB site
Description: structure of human c4b-binding protein alpha chain ccp domains 1 and 2 in complex with the hypervariable region of mutant group a streptococcus m2 (k65a, n66a) protein
Deposited on 2016-02-04, released 2016-07-20
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M protein, serotype 2.1
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: emmL2.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50468
      • engineered mutation (27-28)
  • Chain 'B':
    Compound: c4b-binding protein alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: C4BPA, C4BP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04003 (4-127)
      • expression tag (3)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i0qA (A:)
    gpgsnsknpvpvkkeaklseaelhdkiaaleeekaelfekldkveeehkkveeehkkdhe
    klekksedverhylrqldqeykeqqerqknleelerqsqrevek
    

    Sequence, based on observed residues (ATOM records):
    >5i0qA (A:)
    aklseaelhdkiaaleeekaelfekldkveeehk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i0qB (B:)
    gpgsncgppptlsfaapmditltetrfktgttlkytclpgyvrshstqtltcnsdgewvy
    ntfciykrcrhpgelrngqveiktdlsfgsqiefscsegffligsttsrcevqdrgvgws
    hplpqcei
    

    Sequence, based on observed residues (ATOM records):
    >5i0qB (B:)
    sncgppptlsfaapmditltetrfktgttlkytclpgyvrshstqtltcnsdgewvyntf
    ciykrcrhpgelrngqveiktdlsfgsqiefscsegffligsttsrcevqdrgvgwshpl
    pqcei