PDB entry 5i0n

View 5i0n on RCSB PDB site
Description: pi4k iialpha bound to calcium
Deposited on 2016-02-04, released 2016-03-09
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4-kinase type 2-alpha,Lysozyme,Phosphatidylinositol 4-kinase type 2-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PI4K2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BTU6 (Start-100)
      • linker (101-103)
    • Uniprot D9IEF7 (104-266)
      • conflict (156)
      • conflict (199)
    • Uniprot Q9BTU6 (267-End)
  • Heterogens: ATP, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i0nA (A:)
    gamgtvaaqaqalaaqaaaaahaaqahrernefpedpefeavvrqaelaiercifperiy
    qgssgsyfvkdpqgriiavfkpkneepyghlnpkwtkwlqkgtgnifemlrideglrlki
    ykdtegyytigighlltkspslnaakseldkaigrntngvitkdeaeklfnqdvdaavrg
    ilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrmlqqkrwdeaavnlaksr
    wynqtpnrakrvittfrtgtwdayknlgrdclvlnqgylseagaslvdqklelnivprtk
    vvylasetfnysaidrvksrgkrlalekvpkvgqrfnriglppkvgsfqlfvegykdady
    wlrrfeaeplpentnrqlllqferlvvldyiirntdrgndnwlikydcpmdssssrdtdw
    vvvkepvikvaaidnglafplkhpdswraypfywawlpqakvpfsqeikdlilpkisdpn
    fvkdleedlyelfkkdpgfdrgqfhkqiavmrgqilnltqalkdnksplhlvqmppvive
    tarshqrsssesytqs
    

    Sequence, based on observed residues (ATOM records):
    >5i0nA (A:)
    ernefpedpefeavvrqaelaiercifperiyqsgsyfvkdpqgriiavfkpkneepygh
    lnpkwtkwlqkgtgnifemlrideglrlkiykdtegyytigighlltkspslnaakseld
    kaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmg
    etgvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknlgrd
    clvlnqgylseagaslvdqklelnivprtkvvylasetfnysaidrvksrgkrnriglpp
    kvgsfqlfvegykdadywlrrfeaeplpentnrqlllqferlvvldyiirntdrgndnwl
    ikydcdwvvvkepvikvaaidnglafplkhpdswraypfywawlpqakvpfsqeikdlil
    pkisdpnfvkdleedlyelfkkdpgfdrgqfhkqiavmrgqilnltqalkdnksplhlvq
    mppviveta