PDB entry 5i0g

View 5i0g on RCSB PDB site
Description: cycloalternan-degrading enzyme from trueperella pyogenes in complex with cycloalternan
Deposited on 2016-02-03, released 2016-12-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Glycoside hydrolase family 31
    Species: Trueperella pyogenes [TaxId:1661]
    Gene: CQ11_05330
    Database cross-references and differences (RAF-indexed):
    • Uniprot X4QP62 (0-728)
      • engineered mutation (531)
      • expression tag (729-731)
  • Heterogens: SIN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i0gB (B:)
    mithrprgiehpyarsldqlypaipiagqsltigattsgpcsrmrcfvlwpeheqvfdms
    pvngtdsdaallaggeghlaaaqqaaldadngwqtsiphlpdqdatyyfealtldgrtet
    sesfpltpshwsaepvghididgdrfipdsplwlvssagthrvkfalriegdehvvgfge
    rydqldqrglrldsvvfeqykaqgkhhrtylpmpfaqvvneagrawgfhvettrrtwydv
    aatvsdrilievdlgfeaektpvvrvntwsgsptdvlngfldvagrpaempewifglwas
    gnewntqslvmeqmdrhrnegipvsvvvieawsdeegftifrdaryvpnqgqphrgpdft
    ypsdgawpdpagmirelhergirvilwqiplqktdddlgpealaqgnaliasghvvkepd
    gtpyknrgwwfpnalmpdlsteagrqwwteqrrylvedldidgfktdggehawgsdlrye
    dgrrgdegnnlypvnyaraygdllrsagkypvtfsrsgftgsqahglywagaedstweaf
    rssitagitagacgilywgwdlagfsgpvpeaelyarafaaatfmpimqyhsefhhhelp
    lrdrtpwnvaeqtgcgelidlarhytrvrealrpylvaqtrqclqtgkplmramfydhad
    dpeiwahprqymlgdellinpvtapgattwttylpegqwedywsgevsegghlvtravgw
    diipvyrrvgaal
    

    Sequence, based on observed residues (ATOM records):
    >5i0gB (B:)
    mithrprgiehpyarsldqlypaipiagqsltigattsgpcsrmrcfvlwpeheqvfdms
    pvngtdsdaallaggeghlaaaqqaaldadngwqtsiphlpdqdatyyfealtldgrtet
    sesfpltpshwsaepvghididgdrfipdsplwlvssagthrvkfalriegdehvvgfge
    rydqldqrglrldsvvfeqykaqgkhhrtylpmpfaqvvneagrawgfhvettrrtwydv
    aatvsdrilievdlgfektpvvrvntwsgsptdvlngfldvagrpaempewifglwasgn
    ewntqslvmeqmdrhrnegipvsvvvieawsdeegftifrdaryvpnqgqphrgpdftyp
    sdgawpdpagmirelhergirvilwqiplqktdddlgpealaqgnaliasghvvkepdgt
    pyknrgwwfpnalmpdlsteagrqwwteqrrylvedldidgfktdggehawgsdlryedg
    rrgdegnnlypvnyaraygdllrsagkypvtfsrsgftgsqahglywagaedstweafrs
    sitagitagacgilywgwdlagfsgpvpeaelyarafaaatfmpimqyhsefhhhelplr
    drtpwnvaeqtgcgelidlarhytrvrealrpylvaqtrqclqtgkplmramfydhaddp
    eiwahprqymlgdellinpvtapgattwttylpegqwedywsgevsegghlvtravgwdi
    ipvyrrvgaa