PDB entry 5i07

View 5i07 on RCSB PDB site
Description: tRNA guanine Transglycosylase (TGT) in co-crystallized complex with 6-Amino-4-(2-phenylethyl)-1,7-dihydro-8H-imidazo[4,5-g]quinazolin-8-one
Class: transferase
Keywords: co-crystallization, shigellosis, TRANSFERASE, TRANSFERASE INHIBITOR
Deposited on 2016-02-03, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (Start-385)
      • conflict (311)
    Domains in SCOPe 2.07: d5i07a_
  • Chain 'B':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (Start-385)
      • conflict (311)
    Domains in SCOPe 2.07: d5i07b_
  • Heterogens: GOL, ZN, NE8, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i07A (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i07A (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvratgadiilgntyhlmlrp
    gaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldgsrhmlspe
    rsieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaal
    fgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphy
    lmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsec
    hcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfr
    aryfarns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i07B (B:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i07B (B:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvratgadiilgntyhlmlrp
    gaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldgsrhmlspe
    rsieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaal
    fgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphy
    lmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsec
    hcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfr
    aryfarns