PDB entry 5i05

View 5i05 on RCSB PDB site
Description: Crystal structure of human BMP9 at 1.87 A resolution
Class: signaling protein
Keywords: growth differentiation factor 2, cell proliferation signal, cytokine, angiogenesis, signaling protein
Deposited on 2016-02-03, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth/differentiation factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GDF2, BMP9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i05a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i05A (A:)
    sagagshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtl
    vhlkfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i05A (A:)
    agshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtlvhl
    kfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr