PDB entry 5hzy

View 5hzy on RCSB PDB site
Description: crystal structure of the legionella pneumophila effector protein ravz - p6322
Deposited on 2016-02-03, released 2016-11-09
The last revision was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein RavZ
    Species: Legionella pneumophila subsp. pneumophila strain Philadelphia 1 [TaxId:272624]
    Gene: lpg1683
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZUV9 (15-End)
      • expression tag (5-14)
      • engineered mutation (224)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hzyA (A:)
    mhhhhhhenlyfqgssiyppetswevnkgmnssrlhklyslffdkssafylgddvsvled
    kpltgaygfqskkndqqiflfrpdsdyvagyhvdaksdagwvndkldrrlseisefcska
    tqpatfilpfvemptditkgvqhqvlltisydpkskqltptvydsigrdtyseslssyfk
    gkyrttcdeiltqsiekaikstdftlgkftraaynhqnrltegnsgsytfrtikevisss
    aqgtevkipgsgyitsnsyltsqhvqdiescikyrnlgvvdiesaltegktlpvqlsefi
    valedygklrsqqseksmlnfigysktakltavelligilndikgkneisesqydklvke
    vdclmdsslgklvqfhlknlgaeslqklvlpcvkfddtiddfvtiekdelfdvpditgee
    laskkgieqgaldkeallkqkqiktdlldlreedktglkkplhggikvk
    

    Sequence, based on observed residues (ATOM records):
    >5hzyA (A:)
    hhenlyfqgssiyppetswevnkgmnssrlhklyslffdkssafylgddvsvledkpltg
    aygfqskkndqqiflfrpdsdyvagyhvdaksdagwvndkldrrlseisefcskatqpat
    filpfvemptditkgvqhqvlltisydpkskqltptvydsislssyfkgkyrttcdeilt
    qsiekaikstdftlgkftraaynhqnrltegnsgsytfrtikevisssaqgtevkipgsg
    yitsnsyltsqhvqdiescikyrnlgvvdiesaltegktlpvqlsefivaledygklrsq
    qsegysktakltavelligilndikgkneisesqydklvkevdclmdsslgklvqfhlkn
    lgaeslqklvlpcvkfddti