PDB entry 5hz5

View 5hz5 on RCSB PDB site
Description: FABP5 in complex with 6-Chloro-4-phenyl-2-piperidin-1-yl-3-(1H-tetrazol-5-yl)-quinoline
Class: lipid binding protein
Keywords: lipid binding protein, fatty acid binding protein, cytoplasm, lipid-binding, transport, protein binding
Deposited on 2016-02-02, released 2017-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid-binding protein, epidermal
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hz5a_
  • Heterogens: DMS, SO4, 65X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5hz5A (A:)
atvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlk
ttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecv
mnnvtctriyekve