PDB entry 5hyv

View 5hyv on RCSB PDB site
Description: Crystal Structure of Transketolase with ThDP from Pichia Stipitis
Class: transferase
Keywords: transketolase, TRANSFERASE
Deposited on 2016-02-02, released 2017-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: N/A
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hyva1, d5hyva2, d5hyva3
  • Heterogens: TPP, CA, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hyvA (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsnghacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvhgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltrqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hyvA (A:)
    ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv
    lsnghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic
    ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf
    wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl
    vrltttigfgslaqgthgvhgaplkaddikqlktkwgfnpeesfavpaevtasynehvae
    nqkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklsei
    vlskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgai
    mngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpi
    etlahfratpnisvwrpadgnetsaayksaiesthtphilaltrqnlpqlegssiekask
    ggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeykls
    vlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktv
    afykgkdvvsplrsaf